LL-37

Immune Support
Research

LL-37 is a human antimicrobial peptide crucial for innate immunity, exhibiting broad-spectrum antibacterial and immunomodulating properties. It shows promise in infectious disease, wound healing, and cancer research due to its diverse mechanisms of action.

Sequence

[LL-37, 37 aa]

Quick Stats

Vendors
0

Vendors (0)

No vendors available

Overview

LL-37, also known as human Cathelicidin antimicrobial peptide, is a key component of the innate immune system. It's produced by various cells, including neutrophils, macrophages, and epithelial cells, acting as a first line of defense against pathogens. LL-37 possesses both direct antimicrobial activity and immunomodulatory functions.

This peptide's significance lies in its dual role: directly targeting and neutralizing pathogens while also modulating the immune response to promote healing and resolve inflammation. Its broad-spectrum activity makes it effective against a range of bacteria, fungi, and viruses, while its immunomodulatory properties influence processes like wound healing, angiogenesis, and cytokine production.

LL-37 is the only human cathelicidin, a class of antimicrobial peptides crucial for innate immune defense. Beyond its direct antimicrobial effects, LL-37 has complex immunomodulatory functions including wound healing promotion, angiogenesis, and inflammation modulation.

Mechanism of Action

LL-37's antimicrobial action involves disrupting bacterial membranes through electrostatic interactions. Being cationic, it binds to negatively charged components of bacterial membranes, leading to membrane disruption and cell lysis. It also neutralizes bacterial lipopolysaccharide (LPS), preventing excessive inflammation.

Beyond direct antimicrobial effects, LL-37 modulates the immune response by acting as a chemoattractant for immune cells, modulating cytokine production, and promoting wound healing through effects on epithelial and endothelial cells. It promotes dendritic cell maturation and antigen presentation, bridging innate and adaptive immune system enhancement for comprehensive host defense.

LL-37 disrupts bacterial membranes through electrostatic interactions with negatively charged components. It also binds and neutralizes bacterial lipopolysaccharide (LPS), modulates cytokine responses, promotes wound healing through effects on epithelial and endothelial cells, and acts as a chemoattractant for immune cells.

Key Benefits

  • Broad-spectrum antimicrobial activity
  • Immunomodulation, balancing pro- and anti-inflammatory responses
  • Wound healing promotion through enhanced cell migration and angiogenesis
  • Anti-biofilm effects, disrupting established biofilms

Research & Indications

Research indicates LL-37's potential in infectious disease treatment, particularly against antibiotic-resistant bacteria and in preventing biofilm formation. Its wound-healing properties are investigated for chronic wounds and burns. Emerging research explores its role in cancer, with some studies suggesting direct antitumor effects and modulation of the tumor microenvironment.

Studies show LL-37 can neutralize bacterial lipopolysaccharide (LPS) and prevent excessive inflammation during gram-negative infections by blocking LPS-induced Toll-like receptor 4 (TLR4) activation and subsequent cytokine storm development. Research indicates the peptide promotes dendritic cell maturation and antigen presentation, bridging innate and adaptive immune system enhancement for comprehensive host defense.

Emerging research indicates LL-37 may have direct antitumor effects through selective toxicity to cancer cells, modulation of the tumor microenvironment, and enhancement of anti-tumor immune responses.

Dosing Protocols

Disclaimer: The following dosing information is for research purposes only and does not constitute medical advice. Consult with a qualified healthcare professional before using LL-37.

Typical dosing regimens for LL-37 in research settings vary based on the specific application.

GoalDoseFrequencyRoute
Antimicrobial Support1-5 mg1-2x dailySubQ or IM
Wound Healing2-5 mg1x dailySubQ or Topical

Supplies Needed

For an 8-16 week protocol:

  • Peptide Vials: Quantity needed (e.g., 4-10 vials of 5mg each)
  • Insulin Syringes (U-100): Quantity per week and total (estimate based on injection frequency)
  • Bacteriostatic Water: Volume needed (e.g., 2-3 × 10mL bottles)
  • Alcohol Swabs: One for vial + one for injection site daily

Side Effects & Safety

Side effects may include injection site reactions (redness, swelling, pain). As LL-37 modulates the immune system, there is a theoretical risk of altered immune responses. Further research is needed to fully assess the safety profile.

Storage & Handling

Store lyophilized LL-37 at -20°C. Reconstitute with bacteriostatic water according to the manufacturer's instructions. Once reconstituted, store refrigerated and use promptly.

Compare Prices