IGF-1 LR3

Growth Factors
Muscle Growth Research

IGF-1 LR3 is a long-acting analog of human Insulin-like Growth Factor-1 (IGF-1), promoting muscle growth and repair. It exhibits enhanced potency due to reduced binding to IGF binding proteins.

Sequence

MFPAMPLLFWMQVLAGAESSLRVECGPRLFKRQRARRGLPQQKNHSHQASRKRGLSLYGPPAPSR

Quick Stats

Vendors
0

Vendors (0)

No vendors available

Overview

IGF-1 LR3 (Long R3 IGF-1) is a synthetic analog of human Insulin-like Growth Factor-1 (IGF-1). It is a modified version of native IGF-1, designed for increased potency and a longer half-life in the body. The primary purpose of IGF-1 LR3 is to stimulate muscle growth, enhance recovery, and promote overall tissue repair.

IGF-1 LR3 differs from native IGF-1 due to the substitution of glutamic acid (Arg3) for arginine at position 3, and it has a 13-amino acid extension peptide at the N-terminus. These modifications reduce its binding affinity to IGF binding proteins (IGFBPs), resulting in a longer half-life and increased biological activity compared to native IGF-1.

Because of its enhanced stability and prolonged action, IGF-1 LR3 is often utilized in research settings and by individuals seeking enhanced muscle development and recovery. It should be noted that the use of IGF-1 LR3 is not approved by regulatory agencies for human use in many countries, and it is primarily available for research purposes.

Mechanism of Action

IGF-1 LR3 exerts its effects by binding to the IGF-1 receptor, a tyrosine kinase receptor found on the surface of various cells throughout the body. Upon binding, the receptor activates intracellular signaling pathways, including the PI3K/Akt and MAPK pathways. These pathways regulate cell growth, proliferation, and survival.

The activation of the PI3K/Akt pathway stimulates protein synthesis and inhibits protein breakdown, leading to muscle hypertrophy and tissue repair. Additionally, IGF-1 LR3 promotes glucose uptake into cells, which provides energy for growth and repair processes. The reduced binding to IGFBPs allows IGF-1 LR3 to remain in circulation longer and exert more sustained effects on target tissues.

IGF-1 LR3 also influences the differentiation of myoblasts (muscle precursor cells) into mature muscle fibers, thereby contributing to muscle development. Furthermore, it plays a role in chondrogenesis, the formation of cartilage, which is important for joint health and repair.

Key Benefits

  • Increased Muscle Growth
  • Enhanced Recovery
  • Improved Glucose Metabolism
  • Stimulated Protein Synthesis
  • Support for Joint Health

Research & Indications

Research on IGF-1 LR3 has focused on its potential applications in muscle wasting conditions, such as sarcopenia and cachexia. Studies have investigated its ability to promote muscle mass and strength in animal models. Additionally, research has explored its use in promoting wound healing and tissue regeneration.

IGF-1 LR3 has also been investigated for its potential role in improving glucose metabolism and insulin sensitivity. Some studies suggest that it may help regulate blood sugar levels and improve metabolic function. However, more research is needed to fully understand its effects on glucose metabolism in humans.

While IGF-1 LR3 holds promise in various research areas, it is important to note that its use in humans is still experimental, and it is not approved for therapeutic purposes by regulatory agencies in many regions.

Dosing Protocols

Disclaimer: The following dosing information is for research purposes only and should not be interpreted as medical advice. Always consult with a qualified healthcare professional before using IGF-1 LR3 or any other peptide.

Typical dosing protocols for IGF-1 LR3 vary widely depending on individual goals and research protocols. Common protocols include:

GoalDoseFrequencyRoute
Muscle Growth & Recovery20-50 mcgOnce or twice dailySubQ or IM

A gradual titration schedule is sometimes recommended to minimize potential side effects:

PhaseDaily DoseFrequency
Weeks 1-210 mcgOnce daily
Weeks 3-420 mcgOnce daily
Weeks 5-830-50 mcgOnce daily

Supplies Needed

For an 8-week protocol:

  • Peptide Vials: 1-2 vials of 1mg each (depending on dosage)
  • Insulin Syringes (U-100): 56 syringes (1 per day)
  • Bacteriostatic Water: 1 × 10mL bottle
  • Alcohol Swabs: 56-112 alcohol swabs

Side Effects & Safety

Common side effects of IGF-1 LR3 may include:

  • Hypoglycemia (low blood sugar)
  • Injection site pain or irritation
  • Joint pain
  • Headaches
  • Potential for increased tumor growth (in individuals with pre-existing cancer)

IGF-1 LR3 is contraindicated in individuals with active cancer, pregnancy, or breastfeeding. It should be used with caution in individuals with diabetes or other metabolic disorders.

Storage & Handling

Lyophilized IGF-1 LR3 should be stored at 2-8°C (refrigerated) and protected from light. Upon reconstitution with bacteriostatic water, the solution should be stored at 2-8°C and used within a few weeks. Avoid freezing and repeated freeze-thaw cycles.

Compare Prices